PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 626aa    MW: 69798.9 Da    PI: 6.0399
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496473.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.61.9e-2960144187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+++r++m+ ++r+++ k+plW+evs+k++e g++rs+k+Ckek+en+ k++k++k+g+++++  + +t+++fdqlea
  XP_004496473.1  60 RWPRQETLALLRIRSDMDITFRDASVKGPLWDEVSRKLAELGYNRSAKKCKEKFENVYKYHKRTKDGRGGKS--DGKTYRFFDQLEA 144
                     8********************************************************************964..5557*******85 PP

2trihelix1093e-34449534187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev+aLi++r+e++++++++  k+plWee+s++m+  g++r+pk+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  XP_004496473.1 449 RWPKVEVQALINLRTELDNKYQENGPKGPLWEEISSAMKNLGYNRNPKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 534
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002657119IPR001005SANT/Myb domain
CDDcd122031.19E-2459124No hitNo description
PfamPF138378.0E-1959145No hitNo description
PROSITE profilePS500907.01559117IPR017877Myb-like domain
PROSITE profilePS500907.491442506IPR017877Myb-like domain
SMARTSM007171.1E-4446508IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-5447505IPR009057Homeodomain-like
PfamPF138379.1E-24448535No hitNo description
CDDcd122037.30E-29448513No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MMGESAIMSG GGEGGDAVAV TGSHNMTAEV VSGGGVGSNS GSDIERGRIE EGERSFGGNR  60
WPRQETLALL RIRSDMDITF RDASVKGPLW DEVSRKLAEL GYNRSAKKCK EKFENVYKYH  120
KRTKDGRGGK SDGKTYRFFD QLEALDHIHN HPSTHQPQNL LKQPQSTPTL SQVITTSITE  180
TATMPQVVNT TLSMPHATVP SISMPQNNIV TTQAMNVNIT TIPSNPSTSF QPSTTNPPQS  240
LSFPNIPTDL LSNSMVSSYS TSSDDTMEGT QKRKRKWKDF FEKLMKEVIE KQEQLHKRFL  300
EAIEKREHDR MVREEAWRAQ EMQRINRERE ILAQERSITA AKDAAVMSLL QKIAQQPNLG  360
HALNNINVAQ PLPPQQSPQQ QPPPSKAPTS TPAPTLVAQV INAPPPVQPP PVTPSGPPMV  420
QQQQQIAKNM EIVKFDNNGD NSIGASSSRW PKVEVQALIN LRTELDNKYQ ENGPKGPLWE  480
EISSAMKNLG YNRNPKRCKE KWENINKYFK KVKESNKKRP EDSKTCPYFH QLDALYKEKN  540
KAENSGGGSS QPTNAESMVA PLMVQPEQQW PPQQEGDPME RNRRDEEDDM DEDDKDGEEE  600
DDEEMDEGGG GGSNFEIVAN KPSVGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2255461e-115AC225546.4 Medicago truncatula clone mth2-78i17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496473.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLG7ICZ10.0G7ICZ1_MEDTR; Trihelix transcription factor GT-like protein
STRINGGLYMA20G30640.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-89Trihelix family protein